PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G030600.1
Common NameB456_001G030600, LOC105766286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 666aa    MW: 73057.7 Da    PI: 5.4965
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G030600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.19.3e-29208261155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av++L G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Gorai.001G030600.1 208 KPRVVWSVELHRKFVAAVNHL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 261
                         79*******************.********************************8 PP

2Response_reg80.17.1e-27261341109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ +++l ++l k +y +v+++ ++ +al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ +++ + 
  Gorai.001G030600.1  26 VLAVDDDPICLKVLGTLLLKCQY-QVTTTNQAISALKMLRENRnrYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTKLVMKG 114
                         799********************.***************999889*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Gorai.001G030600.1 115 ITHGACDYLLKPVRIEELKN 134
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.5E-1701664IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.7E-4223178No hitNo description
SuperFamilySSF521722.28E-3523147IPR011006CheY-like superfamily
SMARTSM004488.3E-3324136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.78125140IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-2426134IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.70E-2827139No hitNo description
PROSITE profilePS5129412.375205264IPR017930Myb domain
SuperFamilySSF466897.17E-20205265IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-30206266IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-25208261IPR006447Myb domain, plants
PfamPF002492.6E-7210260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MTMEEKMGGS NREDEALDRF PVGMRVLAVD DDPICLKVLG TLLLKCQYQV TTTNQAISAL  60
KMLRENRNRY DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTKL VMKGITHGAC  120
DYLLKPVRIE ELKNIWQHVV RRKKPDSKDR VNALNQDKAS GGIGEAVQTS TSSSDQKFNK  180
KRKDQNEDEE DDGEDNEHEN DDPSTQKKPR VVWSVELHRK FVAAVNHLGL DKAVPKKILD  240
LMNVEGLTRE NVASHLQKYR LYLKRLSSVA TQQANMVAAL GGKDPSYLRM GSLDGFGDFR  300
TLTGSGRLSS ATLSSYQPSG MFGRLNSSAA LNLRGISSGV IQQGHPQTLS NSINGLGKIQ  360
PVGLPANQNQ NGTLFQGIPT SIELNQLLQN KSANHFGELN PVNNPNVFGV ATNFPDARMT  420
VGSSSSSLST PSGSPLLLQA NTQQAQRSGA FGNQSSLDVA SLNQESFDMG VHGFSNFVDN  480
GRCHENWQNT VQLSSFPSNS LSTCEAFSHE QLHTNNLQES ISWRSSHLND NPIDLSASMA  540
NAGLEDSRGD MQCQISPSNN VIHNIDYAAK QQWGENSSFA GVDSLVAGAP YVQHLEAGKL  600
AFNTKLRSNE DILFEQRKPQ NEFSQNNFET LDVISSPMIK PEQYNETGMM EGELGYDAFP  660
LGSCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-26204267164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5251072e-67HQ525107.1 Gossypium herbaceum clone NBRI_A_EYI1BW401BL3EZ simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012441162.10.0PREDICTED: two-component response regulator ARR12-like
SwissprotQ6K8X61e-147ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A0D2PU230.0A0A0D2PU23_G
STRINGVIT_11s0206g00060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-131response regulator 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]